.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k0z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative polyketide cyclase (NP_977253.1) from BACILLUS CEREUS ATCC 10987 at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 3k0z Target Id 396159
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS27910,NP_977253.1, 3.10.450.50, 327055 Molecular Weight 17975.61 Da.
    Residues 158 Isoelectric Point 5.27
    Sequence cgveektevqllkempkpkamtidpslsqkeatemvhaaqrfyafwdtgkeelipqtvtenffdhtlpk grpqgteglkfaaqnfrkivpnihceiedllvvgdkvtarlsftgthndkkidffaidilhvkdgkite dwhlednltlkqqlgliaee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.219
    Matthews' coefficent 2.19 Rfactor 0.170
    Waters 322 Solvent Content 43.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k0z

    Protein Summary

    Pfam note: This sequence matches the Pfam entry SnoaL (PF07366) which already has structures. SnoaL is part of the NTF2 (CL0051) clan. I have updated the annotation slightly with information from PMID:15071504.

     

    Gene NP_977253.1 from Bacillus cereus atcc 10987 encodes a protein with 179 residues.  This target has been annotated as putative lipoprotein belonging to PF07336. NCB blasting indicates this protein carries a NTF_2 domain.  SSM and Dali searching results also suggest several structural homologues from PF07335, such as 2F99, 2GEY,  3EC9 and 1SJW. The biomolecule of NP_977253.1 should be a dimer.

     

    396159_1.png

    Fig. 1  Protein NP_977253.1  monomer has a conserved NTF_2 domain.

     

    396159_2.png

    Fig. 2  The biomolecule of NP_977253.1   should be a dimer. 

     

     

    396159_3.png

    Fig. 3  Protein NP_977253.1 (green) is structural homolog to 2F99, 2GEY, 3EC9 and 1SJW.

     

     

     

     

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch