.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jzl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative cystathionine beta-lyase involved in aluminum resistance (YP_013912.1) from Listeria monocytogenes 4b F2365 at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 3jzl Target Id 390911
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS20168,YP_013912.1, 3.40.640.10, 85309 Molecular Weight 44876.83 Da.
    Residues 408 Isoelectric Point 5.18
    Sequence mnniqairkkvetqiddlqnktdeiaefnqakvldafqenkvsdfhfhpstgygyddegrdtlervyat vfkteaalvrpqiisgthaistvlfgilrpddellyitgqpydtleeivgirkqgqgslkdfhigyssv pllengdvdfpriakkmtpktkmigiqrsrgyadrpsftiekikemivfvkninpevivfvdncygefv eyqeppevgadiiagsliknpggglaktggyiagkealvdlcgyrlttpgigreagaslysllemyqgf flaphvtaqaikgarftaamlaefgveadpvwdaprtdliqsvsfhnkekmvafaqaiqaaspvnahvl pigaympgyeddvimaagtfiqgasleltadgpirepyqlyvqggltyehikiavtraiqkiv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.241
    Matthews' coefficent 2.10 Rfactor 0.210
    Waters 274 Solvent Content 41.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3jzl

    Protein Summary

    Target ID 390911 belongs to the Alum_res (PF06838) Pfam A group, and proteins belonging to this Pfam group have been implicated in aluminium resistance in some bacteria ( PUBMED:9367855). The structures of orthologs of this protein have been determined by JCSG including PDB ID 3i16, 3hvy, 3gwp, and 3fd0. The structure of target ID was determined at a resolution of 1.91 Angstrom, and phased using Se-SAD. Shown below is a ribbons representation of a monomer of target ID 390911 with the residues color coded with N-terminal residues in blue and C-terminal residues in red. The structure described here is quite similar to the orthologs listed above.

    monomer.png

    Pyridoxal-5'-phosphate (PLP) was added to the crystallization solutions at a concentration of 1 mM. Electron density maps show that PLP (shown in magenta above)  is covalently bound to the protein through a Schiff base interaction with the NZ sidechain atom of Lys 226. Crystal packing indicates that a tetramer is the predominant oligomerization state in solution. Shown below is a ribbons representation of the tetramer.

     

    tetramer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     monomer.png
    No description
    654.91 kB19:52, 14 Jul 2009haxelrodActions
     tetramer.png
    No description
    916.33 kB20:01, 14 Jul 2009haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch