The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative PLP-dependent aminotransferase (NP_978343.1) from Bacillus cereus ATCC 10987 at 2.19 A resolution. To be published
    Site JCSG
    PDB Id 3ju7 Target Id 390490
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS14575,NP_978343.1, 3.40.640.10, 89004 Molecular Weight 43056.77 Da.
    Residues 376 Isoelectric Point 6.50
    Sequence menipflrastvpvieyldelkeidashiytnygpinqrfeqtimsgffqnrgavttvanatlglmaai qlkkrkkgkyalmpsftfpatplaaiwcglepyfidisiddwymdktvlwdkieelkeevaivvpyatf gswmnleeyeelekkgvpvvvdaapgfglmnggmhygqdfsgmiiysfhatkpfgigeggliyskneed iqrikrmgnfgfdtnrectmmgfnckmseyaaaigiatmkkwddklkertrisewykqllqsnglmkkg wqlqkteaviqqfmpilcpeevrnkqviedlkkqkiearlyfspschqqvlfrnykstdltrtnkiakr ivslplwegmtkeiveqiviclgqkvvsade
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.19 Rfree 0.220
    Matthews' coefficent 2.78 Rfactor 0.176
    Waters 300 Solvent Content 55.76

    Ligand Information


    Google Scholar output for 3ju7

    Protein Summary

    This protein is classified in the Pfam clan CL0061 of PLP aminotransferases and specifically belongs to Pfam family PF01041 of DegT/DnrJ/EryC1/StrS aminotransferase family. For other JCSG structures of proteins that belong to this Pfam clan, follow the family link in the Tags section below.

    There are 2 protein molecules in the asymmetric unit in the crystal structure and crystal packing analysis suggests that this is the biologically relevant dimer.

    The protein was co-crystallized with 1mM PLP which formed a Schiff base with the putative active site lysine residue, resulting in the modified residue LLP.


    Ligand Summary





    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    531.89 kB19:42, 22 Jul 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch