.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jq0

    Title Crystal structure of SusD superfamily protein (YP_001299712.1) from Bacteroides vulgatus ATCC 8482 at 1.13 A resolution. To be published
    Site JCSG
    PDB Id 3jq0 Target Id 396554
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS26686,YP_001299712.1, BIG_773, 430297 Molecular Weight 56469.61 Da.
    Residues 492 Isoelectric Point 5.54
    Sequence gtaywknpdqftafntglhallreksynffllgepradiygdnpiggeasqgmerlpfntinkenvgis nygdmykiinqinqmiakttettilteatqnyylgeaygmraylyfhllrswgdvvlyldytegqnldl snitkgvspatevmeqikkdiqasenafgsdysfklgrhfwsaaatqmlkgeaylwsgrqmnggnsdyt iaknafenvkkadvglvtssfkdifsfenkknkemiftihngkdeyemwggyyrmrlipaqdkmvkiyc dengnsfvgtpdaqlngltqlqvrrefyfkgfrnndtrwttslkavykkdaqgvvsyfgpitykfqgtm leggstrsflddfpiyryadcllqlamakvllgedpteeinavreraygskyfnehkaeiaypndndpe fytdnkwmkpdnagaleailkerlrefmfegkrwydirllgwdyvhqyssaeqsrllwpidagtltnns alkqtpgye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.13 Rfree 0.137
    Matthews' coefficent 2.34 Rfactor 0.117
    Waters 860 Solvent Content 47.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3jq0

    Protein Summary

    The protein YP_001299712.1 is annotated as a Putative outer membrane protein, probably involved in nutrientbinding. YP_001299712.1 belongs to PFAM PF07980 SusD_RagB . There are several structures reported in this family.

    The monomer structure is shown below.

    PX9937B.png 

    A search with DALI finds several homologs, as shown below.

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID TITLE (JCSG structures highlighted in red)
    1 3hdx 32.5 2.6 387 456 19 SUSD SUPERFAMILY PROTEIN
    2 3ckc 31.3 2.6 395 501 21 SUSD
    3 3ck8 31.3 2.7 398 501 21 SUSD
    4 3ck7 31.3 2.6 395 496 21 SUSD
    5 3ckb 31.2 2.5 393 501 21 SUSD
    6 3ck9 30.8 2.7 397 508 21 SUSD
    7 3fdh 22.6 3.3 364 472 11 SUSD HOMOLOG
    8 3ejn 20.0 3.6 348 450 10 SUSD HOMOLOG
    9 3gzs 19.5 3.4 365 495 9 UNCHARACTERIZED SUSD SUPERFAMILY PROTEIN
    10 3cgh 19.1 3.5 370 507 9 SUSD HOMOLOG

    A superposition of 3hdx (magenta) with this protein (green) is shown below.

    PX9937B_3hdx.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     PX9937B.png
    No description
    166.39 kB15:40, 23 Jul 2009abhinavkActions
     PX9937B_3hdx.png
    No description
    192.35 kB15:40, 23 Jul 2009abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch