The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative NADPH:quinone oxidoreductase (YP_296108.1) from RALSTONIA EUTROPHA JMP134 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3iup Target Id 394240
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS25787,YP_296108.1, _0073.002733_, 326273 Molecular Weight 39883.43 Da.
    Residues 378 Isoelectric Point 6.40
    Sequence mhsalqlrsrikssgelelsldsidtphpgpdevlirieasplnpsdlgllfgaadmstakasgtaerp ivtarvpegamrsmagrldasmpvgnegagvvveagsspaaqalmgktvaaiggamysqyrcipadqcl vlpegatpadgassfvnpltalgmvetmrleghsalvhtaaasnlgqmlnqiclkdgiklvnivrkqeq adllkaqgavhvcnaasptfmqdltealvstgatiafdatgggklggqiltcmeaalnksareysrygs tthkqvylyggldtsptefnrnfgmawgmggwllfpflqkigreranalkqrvvaelkttfashyskei slaevldldmiavynkratgekylinpnkglag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.208
    Matthews' coefficent 2.34 Rfactor 0.175
    Waters 623 Solvent Content 47.36

    Ligand Information


    Google Scholar output for 3iup

    Protein Summary

    Similar in structure to lots of NDPH reductases (e.g. 2vcy).


    Fig 1. Dimer of 394240 complexed with NDPH


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    MH10766 dimer with NDPH
    124.17 kB17:25, 1 Jul 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch