.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hwu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative DNA-binding protein (YP_299413.1) from Ralstonia eutropha JMP134 at 1.30 A resolution. To be published
    Site JCSG
    PDB Id 3hwu Target Id 396389
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS25913,YP_299413.1, 327604 Molecular Weight 16077.45 Da.
    Residues 146 Isoelectric Point 6.21
    Sequence qelkgkymktptgylmvlrhgdnvlqnleqlardehipsasfvgigfmseatfgfydfgrkqfdpktyr nvemanmtgsiawkegkpsihahgtvtdgtfqgagghllgltvgtgsceitvtvypqrldrfvdpeiqa nvlglpqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.140
    Matthews' coefficent 1.89 Rfactor 0.119
    Waters 155 Solvent Content 35.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hwu
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     
    2. Structure-based de novo prediction of zinc-binding sites in proteins of unknown function
    W Zhao, M Xu, Z Liang, B Ding, L Niu, H Liu - , 2011 - Oxford Univ Press
     

    Protein Summary

    Pfam update: the sequence of this target falls into DUF296.

     

    Gene Reut_B5223 from Ralstonia eutropha jmp134 encodes the protein YP_299413 that belongs to the DUF296 (PF03479) with an AT-hooking motif for possible DNA binding.

    Pre-SCOP classifies 3HWU inside the alpha+beta class, AF0104/ALDC/Ptd012-like superfamily, AF0104 family.

    DALI suggests 3HWU is structurally similar to 3HTN (Z-scr=20), 2DT4 (Z-scr=18), 2H6L (Z-scr=18), 2NMU (Z-scr=16), and 2P6Y (Z-scr=16). In the 3hwu structure there is a piece of unknown electron density observed near to His 117, His119 and His 133. Based on directly superposition comparison, the His 117, 119 and 133 should be structurally conserved for metal-binding.  The likely biomolecule of 3hwu is a trimer.

     

    396389_1.png

     

    Figure 1. 3hwu monomer has a conserved active site for metal-binding.

     

    396389_3.png

    Figure 2. The biomolecule of 3hwu is likely a trimer.

     

     

    396389_2.png

     

    Figure 3. H117, H119 and H133 are conserved for metal-binding in the 3hwu structure.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch