The Open Protein Structure Annotation Network
PDB Keyword


    Title Crystal structure of FMN-binding domain of flavin reductases-like enzyme (YP_001049024.1) from Shewanella baltica OS155 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3hmz Target Id 375054
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS24217,YP_001049024.1,, 92234 Molecular Weight 21856.79 Da.
    Residues 198 Isoelectric Point 5.88
    Sequence mhhqrkthvdnniaavelakayrllnhgptvlvsarsqgidnvmaaawccaldfappkltvvldkmtkt refieqsgmfviqvptvaqlqlthrvgsqsladdankllncgvelfemaghdlpfvagcsawlacklip epnnqlqydlfiaevigawadtqvfnhghwhfdtapadkrslhyiaggqfyaigesfnad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.150
    Matthews' coefficent 2.69 Rfactor 0.129
    Waters 224 Solvent Content 54.22

    Ligand Information


    Google Scholar output for 3hmz

    Protein Summary

    The gene Sbal_0626 from Shewanella baltica OS155 translates into the YP_001049024 protein, a FMN binding flavin reductase domain. It belongs to PFAM PF01613 which is a family of enzymes known to be flavin reductases as well as components of various oxidoreductases and monooxygenases.

    Pre-SCOP classifies 3hmz in the all beta class, FMN binding split barrel superfamily, NAD:FMN oxidoreductase-like family. The 3hmz monomer structure folds into a typical FMN binding domain shown below.


    The 3hmz crystal structure carries a FMN molecule bound to the protein, as shown in stick representation in the above figure. The crystal packing analysis suggests that the functional oligomeric state of the protein is a dimer, shown below, as it is the case with most proteins in this family.


    3hmz structure is very similar to many other reductases as observed by DALI and SSM searches.

    DALI Structures Similar to 3HMZ
    1 3e4v 24.6 1.8 171 179 26 NADHFMN OXIDOREDUCTASE LIKE PROTEIN
    4 2r6v 20.4 1.9 160 182 24 UNCHARACTERIZED PROTEIN PH0856
    5 3bnk 19.9 2.1 161 186 23 FLAVOREDOXIN
    6 1eje 19.8 1.8 162 192 17 FMN-BINDING PROTEIN
    8 2d5m 19.3 2.1 160 183 24 FLAVOREDOXIN
    10 1rz1 17.2 1.9 135 153 21 PHENOL 2-HYDROXYLASE COMPONENT B


    A superposition of these proteins on this target reveals the conservation of the core domain.


    However, there are some differences in the orientation of the N-terminus in these structures.



    3hmz (green) and 3e4v (deepteal; another JCSG structure) are very similar.                                         


    However, 1eje (cyan), 1rz1 (lightmagenta), 1usc (yellow), 1usf (salmon), 2d5m (lightgrey), 2r6v (slate), 3bnk (orange), 3bpk (lime), 3fge (hotpink) have their N-terminus oriented in the opposite direction.


    Literature references
    1. Blanc V, Lagneaux D, Didier P, Gil P, Lacroix P, Crouzet J; , J Bacteriol 1995;177:5206-5214.: Cloning and analysis of structural genes from Streptomyces pristinaespiralis encoding enzymes involved in the conversion of pristinamycin IIB to pristinamycin IIA (PIIA): PIIA synthase and NADH:riboflavin 5'-phosphate oxidoreductase. PUBMED:7665509

    2. Parry RJ, Li W; , J Biol Chem 1997;272:23303-23311.: An NADPH:FAD oxidoreductase from the valanimycin producer, Streptomyces viridifaciens. Cloning, analysis, and overexpression. PUBMED:9287340

    Ligand Summary




    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch