.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hk4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-like protein of unknown function (NP_107719.1) from Mesorhizobium loti at 1.96 A resolution. To be published
    Site JCSG
    PDB Id 3hk4 Target Id 390969
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS20864,NP_107719.1, 3.10.450.50, 323944 Molecular Weight 13153.97 Da.
    Residues 117 Isoelectric Point 4.91
    Sequence mtiaeiakdftellkqgdnagaaekynaddiasyeamegpmavshgkealrqksqwwqenhevhggsve gpyvngdqfalrfkfdvtpkatgervtmdevglytvkngkiteerfyy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.96 Rfree 0.220
    Matthews' coefficent 2.24 Rfactor 0.177
    Waters 285 Solvent Content 45.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hk4

    Protein Summary

    Gene mlr7391 from MESORHIZOBIUM LOTI encodes the NP_107719.1 protein with 117 residues. 
    The search results from NCBI sequence alignment indicate this hypothetic protein carries a fold belonging to the NTF2_like superfamily protein.  It classifies inside the SnoaL-like polyketide cyclase group (PF07366). It has been suggested as a structural homolog to 1NU3, 1SJW and 1TUH by FFAS and SSM.  There are 4 subunits in each asymmetric unit cell. The interface interaction indicates that the biomolecule of protein NP_107719.1 should be a dimer.

     

    390969_1.png

    Figure 1. Protein NP_107719.1  monomer carries the

    α/β-barrel folding core belonging to the NTF_2 superfamily.

     

    390969_3.png

    Figure 2. The biomolecule of NP_107719.1 (Green) should be a dimer based on interface interaction.


     

     

    390969_2.png

    Figure 3. The biomolecule of NP_107719.1 (Green) should be a structural homolog to  1TUH(cyan), 1SJW (magenta) and 1NU3(yellow).

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch