The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative exopolyphosphatase (17739545) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 3hi0 Target Id 394589
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS25328,17739545, _0031.003060_, _0023.001152_, _0066.001282_, 333014 Molecular Weight 55587.45 Da.
    Residues 507 Isoelectric Point 5.71
    Sequence mtrseaqgrltglapvsvidigsnsvrlvvyeglsrapavlfnekvlcglgkglaltgrmheegvtral malrrfhvlseqaqaqklyvlataaareaengpdfireaeailgceievlsgekealysaygvisgfyq pdgiagdlgggslelidikdkscgegitlplgglrlseqsdgslekaatiarkhvksfakllaagegrt fyavggtwrniaklhmeisgyplhmmqgyelpleemlnfleevivsrdskdpawqavsknrrsllpfga iamrevlramkpakiafsaqgvregylysllteaeresdpllvaadelailrarspehareladwsgrt fpvfgideteeesryrqaaclladiswrahpdyrglqalniiahssfvaithpgrayialanyyrfegl ndngtteplaamagerlqelgkllggllrvvylfsasmpgvvdhlkfrksdnpdidlefvvphdycdfa gerldgrlqqlakltgkrlafvfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.233
    Matthews' coefficent 2.74 Rfactor 0.186
    Waters 287 Solvent Content 55.06

    Ligand Information


    Google Scholar output for 3hi0
    1. Enzymatic activity of the soybean ecto-apyrase GS52 is essential for stimulation of nodulation
    K Tanaka, CT Nguyen, M Libault, J Cheng - Plant , 2011 - Am Soc Plant Biol

    Protein Summary

    394589 is an exopolyphosphatase (Ppx) with a novel domain swapping compared to other Ppxs (Figure 1). There are several Ppx structures (2flo, 1u6z,1t6d/1t6c,3cer, 2j4r). Ppx functions as a dimer, so domain arrangement is the same with the dimer despite the swapping (Figure 2).


    This protein is now in family PF02541.9 Ppx-GppA CL0108 along with other structures.


    Figure 1. Comparison of 394589 (green) to 2flo, showing the significant different in 3rd domain.


    Figure 2. 394589 dimer (top) vs 1u6z dimer (bottom)

    mg15448h-dimer.png394589 dimer1u6z-dimer.png1u6z dimer

    Ligand Summary




    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch