.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h4y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative chemotaxis protein (YP_009526.1) from DESULFOVIBRIO VULGARIS HILDENBOROUGH at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3h4y Target Id 394351
    Molecular Characteristics
    Source Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
    Alias Ids TPS25792,YP_009526.1, _0037.001839_, 325484 Molecular Weight 16194.88 Da.
    Residues 155 Isoelectric Point 6.05
    Sequence msvngievakpfiaatvnvlstmagiqpqpgkpyvkknnvakgdvsavigitghkngsisvtftkscai alvkgmlgddiqdilqdtkdavgevtnmisgqaraglaemgmvfqgstpsvimgdghtishvtkspima ipfltnhgeftvefcfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.196
    Matthews' coefficent 2.29 Rfactor 0.162
    Waters 146 Solvent Content 46.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3h4y

    Protein Summary

    Pfam update: This protein is now in family PF04509.5 CheC CL0355.

    Gene DVU_0302 from Desulfovibrio vulgaris hildenborough encodes the YP_009526 protein that belongs to the CheC-like group (PF04509). This protein is annotated as a CheX protein in the chemotaxis signaling pathway.

    SCOP classifies 3h4y in alpha+beta class, CheC-like (super)family. DALI provides top hits with other CheX proteins like 3hm4 (Z-scr=27), 3h2d (Z-scr=23), 3iic (Z-scr=23), 1xko (Z-scr=20), 1squ (Z-scr=20).

    3h4y structure from two crystals with 1 molecule/asymmetric unit (1.55A, space group P421212) and with 2 molecules/asymmetric unit (1.65A, space group P212121).

    The dimer which is the biological unit from the structure from the first crystal is the same form as the dimer from the second crystal and there are no significant structural differences in the structures from the two crystals. There is a small conformation difference in the residue range 78-82 but is is probably not functionally important based on the biochemical studies done on another CheX protein (Ref 1, PDB id 1XKO). Refinement was completed with the first higher resolution structure. The monomer (green) is superimposed on the predicted dimer (cyan and red):

    Fig1.png

    The crystal structure of 1XKO was solved by molecular replacement using the structure of the CheX from Thermotoga maritima solved in the structural genomics effort (PDB id 1SQU).

    The JCSG has recently detemined the crystal structures of two other CheX proteins (3h2d; 3hm4) and informative structural comparisons are available at their respective TOPSAN entries, protein NP_719446.1 from Shewanella oneidensis and  YP_386777 from Desulfovibrio desulfuricans g20   

     

    References:

    1. Structure and function of an unusual family of protein phosphatases: the bacterial chemotaxis proteins CheC and CheX. Park SY, Chao X, Gonzalez-Bonet G, Beel BD, Bilwes AM, Crane BR. Mol Cell. 2004 Nov 19;16(4):563-74.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    387.83 kB00:30, 8 Apr 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch