.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gz7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative antibiotic biosynthesis monooxygenase (NP_888398.1) from BORDETELLA BRONCHISEPTICA at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 3gz7 Target Id 390479
    Molecular Characteristics
    Source Bordetella bronchiseptica rb50
    Alias Ids TPS20148,NP_888398.1, 3.30.70.900, 85589 Molecular Weight 11025.01 Da.
    Residues 96 Isoelectric Point 5.66
    Sequence miqeiasilvqpgreadfeagvaqarplfmrargchgvalhrsieapqrytlvvdwetvdnhmvdfrqs adfqewrklvgecfaeppqvhheqkvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.236
    Matthews' coefficent 2.15 Rfactor 0.174
    Waters 145 Solvent Content 42.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gz7

    Protein Summary

     Pfam update:This protein is now in family PF03992.9 ABM, CL0032, and there are other structures.

    This protein is annotated as a hypothetical protein BB1853 [Bordetella bronchisept
    ica RB50] in PSCA. It belongs Pfam; PF03992; Antibiotic Biosynthesis Monooxygenase (ABM) family.

    It is present as a dimer in the crystal structure and crystal packing analysis suggests that this dimer should be the stable oligomeric  form in solution.

     

    Fig1_MG7794B.png

        Fig 1. Dimer of 390479 in asu.

     

    The 390479 is structurally similar to 1lq9 ( Dali Z=12.2, 2.5A rmsd, 12 %id). The comparison of the active site of 390479 (green) with 1lq9 (light blue) shows a match on Trp 56 (Trp 66) residue. The details are shown below.   

     

    FIg2_MG7794B (1).png

      Fig 2. From left top Leu52 (Asn 62), Leu 40- green (Tyr 51- light blue).

                From left bottom His 62 (Tyr 72 -dual conf.) and Typ 56 (Trp 66) of 390479 - green (1lq9- light blue).

                (Citrate ligand is not shown in this Fig.)

     

     

    FIg2_MG7794B_CIT.png

     

     Fig. 3. The same view as Fig 2 with a citrate molecule in the active site.

               A citrate molecule (CIT- pink, ball-and-stick model) is modeled in the active site of both A and

               B molecules of 390479 (green).

     

    Ligand Summary

     

    Citrate (CIT) molecules were modeled based on crystallization conditions.

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch