.
The Open Protein Structure Annotation Network
PDB Keyword
.

3goh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alcohol dehydrogenase superfamily protein (NP_718042.1) from Shewanella oneidensis at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3goh Target Id 394266
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS25300,NP_718042.1, 326841 Molecular Weight 34667.01 Da.
    Residues 314 Isoelectric Point 6.55
    Sequence meqhqvwayqtkthsvtlnsvdipalaaddilvqnqaiginpvdwkfikanpinwsnghvpgvdgagvi vkvgakvdskmlgrrvayhtslkrhgsfaeftvlntdrvmtlpdnlsferaaalpcplltawqafekip ltkqrevlivgfgavnnlltqmlnnagyvvdlvsaslsqalaakrgvrhlyrepsqvtqkyfaifdavn sqnaaalvpslkanghiiciqdripapidpaftrtisyheialgalhdfgdrqdwqilmqqgealltli aqgkmeiaapdifrfeqmiealdhseqtklktvltlne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.203
    Matthews' coefficent 2.50 Rfactor 0.172
    Waters 238 Solvent Content 50.72

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3goh

    Protein Summary

    NP_718042.1 is likely an apo-form of a NADP reductase, it has significant sequence homology to 3fbg, 3b6z and 3b70 (~30% id). The NADP binding site is located at the domain interface, based on similar structures such as 3b70 (Fig 1). The putative active site near H88/C125 is not conserved in comparison to 3b70 or 3fbg, likely suggesting different substrate in these enzymes.

     

    This protein is now in family PF08240.5 ADH_N CL0296 along with other structures.

     

    Figure 1. comparison of 394266 monomer with 3b70 (white), the NADP is shown as white ball-and-stick

    ml0298-3b70.png

    Figure 2. Active site near the domain interface (GOL in ball-and-stick)

    mh0298l-act.png

     

    Ligand Summary

    A well ordered GOL is present in the putative active site near residues H88, C125

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     mh0298l-act.png
    MH0298L active site
    189.02 kB18:56, 25 Feb 2009qxuActions
     ml0298-3b70.png
    394266 superimposed with 3b70 (white)
    262.64 kB18:37, 25 Feb 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch