The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative membrane-associated protein of unknown function (YP_211325.1) from Bacteroides fragilis NCTC 9343 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 3g3l Target Id 393243
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS24861,YP_211325.1, 332464 Molecular Weight 34517.78 Da.
    Residues 326 Isoelectric Point 4.71
    Sequence aevdqatkpaeakyyiagtitdattgqelttakvtlgdksvtssfneqvnykaegyalvvsadgyypvk rqvylnqvsdgqtsvatvnvalvsveaavippvvpptdpetdinegeatkvadkavevakpsestvtdm lagttatpeekkaldetlemaggmkvgettpevladgsilaitpvkftnpiqdapamvpyfynegcelt gdvkevaapvtradgavaadiqkaflsnaakalnmnagfvqkigytrisvlngysilgytikgqlvskk ltflisgkyyegivsyqksvmiypnyyshdshdshdshgfnpnagggsnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.206
    Matthews' coefficent 4.28 Rfactor 0.170
    Waters 210 Solvent Content 71.25

    Ligand Information


    Google Scholar output for 3g3l

    Protein Summary

    YP_211325.1 is annotated as a hypothetical protein. The protein can not be assigned to any PFAM family either on the basis of its sequence.

    The protein structure consists of beta-sheet mostly and two distinct domains can be seen in the structure: a small beta-barrel domain on the top and a larger strand+helix domain.


            Secondary structures                                                      N-terminal domain (green) and C-terminal domain (cyan)

    The structure seems to be unique; a search for structural homologs through SSM and DALI servers does not return any significant hits.


    Another search for structural homologs based on the two indidual domains of the protein return some hits.
    N-terminal domain (residues 41-128):
    DALI Results:
















    Carboxypeptidase Gp180 Residues 503-882








    Carboxypeptidase Gp180 Residues 503-882








    Carboxypeptidase N Catalytic Chain








    Pyrogallol Hydroxytransferase Large Subunit








    Possible Transglutaminase-Family Protein








    Carboxypeptidase M








    Catechol 1,2-Dioxygenase








    3-Chlorocatechol 1,2-Dioxygenase








    Chlorocatechol 1,2-Dioxygenase








    Catechol 1,2-Dioxygenase

    SSM Results:










    Possible Transglutaminase-Family Protein





    Pucm In The Presence Of 8-Azaxanthine





    Family 41 Carbohydrate Binding Module





    Middle Domain Of The Caf1a Usher

    C-terminal domain (residues 129-336):
    DALI Results:
















    Hemolytic Lectin From Laetiporus Sulphureus








    Hemolytic Lectin From Laetiporus Sulphureus








    Hemolytic Lectin Lsla


















    SSM     Results:










    F17a-G Lectin Domain





    Heme-Isdc Complex


    An examination of the above structures compared with this target indicates that 2boy (cyan) and 3e8v (magenta) are closest match to the N-terminal domain of this target (green) (see below). This suggests a possible role of transglutaminase/dioxygenase for the N-terminal domain.


     Although the top DALI hit, 1h8l, has the best match for 79 residues, this represents a small domain of this protein (see below) and thus may not represent the same function. Moreover, the Zn ion and the bound inhibitor, GEM, are located in the active site on the other side of the protein.



    N-terminal domain (green) superimposed on 1h8l (magenta)

    Similarly, the closest match for the C-terminal domain is 1w3f, a hemolytic lectin protein. A superposition is shown below (target green, 1wef magenta).  Judging by the differences in size of these structures as well as presence of helices in this target, it may not be reasonable to assign 1wef's function to this target.


    Ligand Summary




    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch