The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of nitroreductase family protein (YP_877874.1) from Clostridium novyi NT at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 3g14 Target Id 391675
    Molecular Characteristics
    Source Clostridium novyi nt
    Alias Ids TPS14654,YP_877874.1,, 85705 Molecular Weight 21618.74 Da.
    Residues 192 Isoelectric Point 5.37
    Sequence mefyevikkrksikkfeqtaidrdkllkiidmamrapswknktpykfivvesdklkldianaienktsa aseavlnspmtivavanpeesgdvsgkeiylidtaiamehivlgatdegygtcwiaafnenkikealki pdnlrvvaltplgvpkdsaedephhpkkdmdeylyidkwgtsfmesnvkilekn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.219
    Matthews' coefficent 1.99 Rfactor 0.173
    Waters 275 Solvent Content 38.14

    Ligand Information


    Google Scholar output for 3g14

    Protein Summary

    This protein is annotated nitroreductase family protein [Clostridium novyi NT] with Pfam; PF00881; Nitroreductase.


    It is present as a dimer in the crystal structure and crystal packing analysis suggests that this dimer should be the stable oligomeic form in solution.



    Fig 1. Dimer of 391675 in asu.


    Other protein structures that are most similar in structure (by DALI) to this protein are putative NADH oxidase (3e10, Z=19.1, 1.8A rmsd, 143 Ca aglined, 27%id), putative nitroreductase (3e39, Z=18.7, 1.6A rmsd, 146 Ca aglined, 20%id) and nitroreductase (1nec, Z=18.7, 2.4A rmsd, 151 Ca aglined, 19%id). The superposition of 391675 dimer with those of 3e10 and 3e39 are shown as below. 




    Fig 2. Superposition of 391675 (green) dimer with those of 3e10 (light pink) and 3e39 (light blue). Please notice that the dimer formation of three structures are almost identical.  

    Ligand Summary


    Sulfate (SO4), Acetate (ACT) ions and Glycerol (GOL) molecule were bound.




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    No description
    256.61 kB08:36, 12 Dec 2008gyewonActions
    No description
    450.33 kB08:48, 12 Dec 2008gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch