.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fzq

    Title Crystal structure of putative haloacid dehalogenase-like hydrolase (YP_001086940.1) from Clostridium difficile 630 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 3fzq Target Id 388088
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS24253,YP_001086940.1, 60679758, 85896 Molecular Weight 31543.63 Da.
    Residues 273 Isoelectric Point 6.40
    Sequence mklykllildidgtlrdevygipesakhairlcqknhcsvvictgrsmgtiqddvlslgvdgyiagggn yiqyhgellynqsfnqrlikevvcllkkrevafsiesqekvfmnqkakeifetmnqlkgtnscinkqhi qekityennieeyksqdihkiclwsnekvfdevkdilqdkmelaqrdissqyyeiiqkdfhkgkaikrl qerlgvtqketicfgdgqndivmfqasdvtiamknshqqlkdiatsicedifdngiykelkrrnii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.230
    Matthews' coefficent 2.49 Rfactor 0.188
    Waters 359 Solvent Content 50.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fzq

    Protein Summary

    YP_001086940.1 is a hydrolase and belongs to PFAM PF08282 which contains haloacid dehalogenase-like hydrolase enzymes.

    The monomer structure consists of two domains; each domain comprising of a sheet and helices, as shown below.

    GD4176A.png

     

    There are numerous structural homologs of this protein. Top ten hits from Dali search are tabulated below.

    DALI Structural Homologs

    N PDB Z-score RMSD LALI NRES %ID TITLE
    1 1ymq 30.4 2.9 254 260 24 SUGAR-PHOSPHATE PHOSPHATASE BT4131
    2 2rbk 30.2 2.7 252 261 25 PUTATIVE UNCHARACTERIZED PROTEIN
    3 2rb5 30.2 2.8 254 261 24 PUTATIVE UNCHARACTERIZED PROTEIN
    4 2rav 30.2 2.7 254 261 24 PUTATIVE UNCHARACTERIZED PROTEIN
    5 2rar 30.2 2.7 252 261 24 PUTATIVE UNCHARACTERIZED PROTEIN
    6 2qyh 28.5 2.7 251 256 24 HYPOTHETICAL CONSERVED PROTEIN, GK1056
    7 2pq0 28.5 2.7 249 256 24 HYPOTHETICAL CONSERVED PROTEIN GK1056
    8 1nrw 27.2 2.8 250 285 20 HYPOTHETICAL PROTEIN, HALOACID DEHALOGENASE-LIKE
    9 1rkq 26.5 3.4 253 271 19 HYPOTHETICAL PROTEIN YIDA
    10 3dnp 26.2 2.6 245 275 18 STRESS RESPONSE PROTEIN YHAX

     

    A superposition of the above structures is shown below with the following color scheme: YP_001086940.1 (green), 1nrw (cyan), 1rkq (lightmagenta), 1ymq (yellow), 2pq0 (salmon), 2qyh (lightgrey), 2rar (slate), 2rav (orange), 2rb5 (lime), 2rbk (deepteal), 3dnp (hotpink).

    GD4176A_others.png

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     GD4176A.png
    No description
    105.37 kB16:25, 4 Dec 2008abhinavkActions
     GD4176A_others.png
    No description
    230.79 kB16:25, 4 Dec 2008abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch