.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ff0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein PhzB2 with cystatin-like fold and unknown function in phenazine biosynthesis (NP_250591.1) from PSEUDOMONAS AERUGINOSA at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3ff0 Target Id 391122
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS18326,NP_250591.1, 3.10.450.50, 87429 Molecular Weight 19026.64 Da.
    Residues 162 Isoelectric Point 5.87
    Sequence mldnaipqgfedavelrrknretvvkymntkgqdrlrrhelfvedgcgglwttdtgspivirgkdklae havwslkcfpdwewynikvfetddpnhfwvecdghgkilfpgypegyyenhflhsfelddgkikrnref mnvfqqlralsipvpqikregipt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.181
    Matthews' coefficent 3.37 Rfactor 0.155
    Waters 272 Solvent Content 63.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ff0
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    Gene phzB2 from Pseudomonas aeruginosa PAO1 encodes the NP_250591 protein that belongs to the phenazine biosynthesis protein A/B group (PF03284). Analysis of its genome context indicates a functional link with the phenazine biosynthesis proteins PhzC, D and E (score 0.77).

    PhzB shares similarity with both subunits of anthranilate synthase and the phzB open reading frame complemented an E. coli trpE mutant deficient in anthranilate synthase activity.[Ref] Products of the phzA and phzB genes are highly homologous to each other and may be involved in stabilization of a putative PCA-synthesizing multienzyme complex.[Ref] The results of cluster analyses indicated that the products of the phzA and phzB genes of P. aeruginosa strain PA14 most closely resemble PhzA2 and PhzB2 from P. aeruginosa PAO1.[Ref]

    Pre-SCOP classifies 3ff0 in the alpha+beta class, NTF2-like superfamily, hypothetical protein YesE family. SSM and DALI search hits are with the phenazine biosynthesis related proteins 3jum, 3dzl and 3b4o (Z=25), the NTF-2 like protein of unknown function 3ebt (1.9A rmsd, 118 Ca aligned, 11% id; Z=13) and 3ec9 (2.15A rmsd, 118 Ca aligned, 12% id; Z=13), as well as with a putative isomerase YesE 1s5a (2.12A rmsd, 123 Ca aligned, 21%id; Z=16).

    3ff0 assembles as a dimer in the crystallographic asymmetric unit, which is also its biological relevant state. Interestingly, an unknown ligans (UNL) is found in the putative active site of each protomers. The density is similar in shape to nitrobenzene or benzoic acid.

     

     dimer_93611.png

     

    Fig 1. Dimer structure of 3ff0.

     

     super_3ebt_1s5a_NBZ.png

     

    Fig 2. Superposition of 3ff0 (green) with 3ebt (light blue) and 1s5a (yellow). UNL ligand of 3ff0 is shown as stick.

    Ligand Summary

    NBZ modeled based on electron density. GOL molecules were modeled from cryo condition.
     

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch