.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fcn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an alpha-helical protein of unknown function (Pfam01724) (YP_428290.1) from RHODOSPIRILLUM RUBRUM ATCC 11170 at 1.45 A resolution. To be published
    Site JCSG
    PDB Id 3fcn Target Id 383760
    Molecular Characteristics
    Source Rhodospirillum rubrum atcc 11170
    Alias Ids TPS7441,YP_428290.1, PF01724, 92905 Molecular Weight 18369.78 Da.
    Residues 163 Isoelectric Point 4.66
    Sequence mgmehktyeadlfvwcqqqadglralsrsrrdlpddldlehiaeeiedmgrselreatslvrqicvrvi mamsapeapdrarwrsevvswhnllldtitpgmidridigviwrravseakaalieinvapqaglsfqa plpadhfldedfdydatvarlgpta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.184
    Matthews' coefficent 2.95 Rfactor 0.161
    Waters 303 Solvent Content 58.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fcn

    Protein Summary

    383760 is a small protein that has a novel all-alpha fold. The N-terminal helical hairpin is likely to function as a dimerization module. This protein is a member of PFam family PF01724. The function of this protein is unknown. One protein sequence contains a fusion of this protein and a DnaB domain, suggesting a possible role in DNA helicase activity (hypothetical). Dali hits have low Z and high rmsd, suggesting probably only topological similarities (not functional relevance).

     

    Dali top hits (11/18/2008):

      No:  Chain   Z    rmsd lali nres  %id  Description
       1:  2gq3-A  6.1  3.6  103   720   10   MOLECULE: MALATE SYNTHASE G;                                        
       2:  1y8b-A  5.0  4.2  109   723    6   MOLECULE: MALATE SYNTHASE G;                                        
       3:  1l5j-A  5.0  5.2   62   862   13   MOLECULE: ACONITATE HYDRATASE 2;                                    
       4:  2odu-A  4.7  2.7   66   217   11   MOLECULE: PLECTIN 1;                                                
       5:  1ucu-A  4.7  2.8   65   494    9   MOLECULE: PHASE 1 FLAGELLIN;                                        
       6:  2bvl-A  4.6  2.4   58   543    7   MOLECULE: TOXIN B;                                                  
       7:  2v6y-A  4.5  1.7   50    75   12   MOLECULE: AAA FAMILY ATPASE, P60 KATANIN;                           
       8:  2dnx-A  4.5  3.5   71   130    8   MOLECULE: SYNTAXIN-12;                                              
       9:  1s4b-P  4.5  2.4   58   654    7   MOLECULE: THIMET OLIGOPEPTIDASE;                                    
      10:  2iml-D  4.4  2.4   57   197    9   MOLECULE: HYPOTHETICAL PROTEIN;                                     
      11:  1a32    4.4  2.5   56    85   14   MOLECULE: RIBOSOMAL PROTEIN S15;                                    
      12:  2b0h-A  4.3  3.9   81   137    7   MOLECULE: TALIN-1;                                                  
      13:  2ajq-A  4.3  2.2   51   704    6   MOLECULE: T7 DNA POLYMERASE;                                        
      14:  1ugo-A  4.3  3.3   71    99    7   MOLECULE: BCL2-ASSOCIATED ATHANOGENE 5;                             
      15:  1knp-A  4.2  2.9   68   529    4   MOLECULE: L-ASPARTATE OXIDASE;                                       

     

    Figure 1. Monomer of 383760

    fp6436a-monomer.png

    Figure 2. Dimer of 383760

    fp6436a-dimer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     fp6436a-dimer.png
    dimer of 383760
    52.26 kB00:24, 18 Nov 2008qxuActions
     fp6436a-monomer.png
    monomer of 383760
    36.88 kB00:24, 18 Nov 2008qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch