The Open Protein Structure Annotation Network
PDB Keyword


    Title Crystal structure of putative polyketide cyclase (YP_611791.1) from SILICIBACTER SP. TM1040 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3f8h Target Id 391384
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS20227,YP_611791.1, 3.10.450.50, 336145 Molecular Weight 14573.45 Da.
    Residues 131 Isoelectric Point 4.79
    Sequence mndtiaryfdafnagdtdgmlaclsedvahhvnegnirvgkekfaafcahmshcykeeltdmvifatpd atraaaeytvngtylatdeglpearqqsyklpagsffdlrdglitrvttyynlsdwikqvsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.213
    Matthews' coefficent 2.87 Rfactor 0.167
    Waters 272 Solvent Content 57.09

    Ligand Information


    Google Scholar output for 3f8h

    Protein Summary

    Gene TM1040_3560 from Silicibacter sp. tm1040 encodes the YP_611791 protein from the SnoaL-like polyketide cyclase family (PF07366). Genome context analysis predicts (score 0.96) a functional link of this target with its genomic neighbor TM1040_3558 annotated as nitrilase/cyanide hydratase and apolipoprotein N-acetyltransferase.

    3f8h classifies in the alpha+beta class, NTF2-like superfamily, SnoaL-like polyketide cyclase family (?). DALI returns as top hits putative polyketide cyclases like PDB:3i0y (Z=21), PDB:3f7x (Z=21), PDB:3kkg (Z=16), PDB:3ebt (Z=15), PDB:2f98 (Z=15), PDB:3d9r (Z=15). 

    SSM Structure Alignment Results
    N  Scoring   Rmsd  Nalgn Ng %seq Query Target (PDB entry)
     Q   P   Z  %sse Match %sse Nres Title
    9 0.55 5.4 7.0 1.77 120 5 17 80 1sjw:A 89 142 STRUCTURE OF POLYKETIDE CYCLASE SNOAL
    12 0.54 4.3 5.9 1.72 109 5 18 70 1k41:B 88 121 CRYSTAL STRUCTURE OF KSI Y57S MUTANT


    The protein crystallizes as a dimer in the 3f8h structure which may represent its solution state, too. 3f8h structure is shown below which consists of a six stranded beta sheet flanked by helices.


    One calcium ion (magenta sphere above) is observed in the crystal structure that interacts with both chains of the dimer, but coming from symmetry related molecule. Thus, it may not be of functional significance and may simply help facilitate crystal packing in the unit cell. Residues ASP 16 and ASP 18 along with three water molecules interact with the ion, as shown below.




    Structural superposition of 3f8h (green) with 2f98 (magenta), 3d9r (yellow), 3ebt (pink), and 3ehc (grey) is displayed below.



    Ligand Summary


    1. Sultana A, Kallio P, Jansson A, Wang JS, Niemi J, Mantsala P, Schneider G; , EMBO J 2004;23:1911-1921.: Structure of the polyketide cyclase SnoaL reveals a novel mechanism for enzymatic aldol condensation.  PUBMED:15071504




    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch