.
The Open Protein Structure Annotation Network
PDB Keyword
.

3edo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Flavoprotein in Complex with FMN (YP_193882.1) from Lactobacillus acidophilus NCFM at 1.20 A resolution. To be published
    Site JCSG
    PDB Id 3edo Target Id 388454
    Molecular Characteristics
    Source Lactobacillus acidophilus ncfm
    Alias Ids TPS7521,YP_193882.1, 60683539, 85967 Molecular Weight 17002.15 Da.
    Residues 150 Isoelectric Point 4.81
    Sequence makktlilyyswsgetkkmaekinseikdselkevkvsegtfdadmyktsdialdqiqgnkdfpeiqld nidynnydliligspvwsgypatpiktlldqmknyrgevasfftsagtnhkayvshfnewadglnvigv arddsevdkwsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.20 Rfree 0.160
    Matthews' coefficent 2.63 Rfactor 0.136
    Waters 616 Solvent Content 53.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3edo
    1. Expansion of the protein repertoire in newly explored environments: human gut microbiome specific protein families
    K Ellrott, L Jaroszewski, W Li, JC Wooley - PLoS computational , 2010 - dx.plos.org
     
    2. Crystal structure of the multicopper oxidase from the pathogenic bacterium Campylobacter jejuni CGUG11284: characterization of a metallo-oxidase
    CS Silva, P Duro, A Fillat, PF Lindley, LO Martins - Metallomics, 2012 - xlink.rsc.org
     

    Protein Summary

    The LBA1001 gene from Lactobacillus acidophilus (accession number YP_193882, gi number 58337297) encodes 17 kDa, 150 amino acid long protein that has been annotated as a putative trp repressor binding protein.  This annotation was probably based on the sequence similarity between this protein and trp repressor binding proteins (for example FFAS detected 22% sequence identity between this protein and Flavoprotein wrbA, PDB code: 36bi, FFAS score: -47.400).  While, 3b6i was originally named tryptophan (W) repressor binding protein (wrbA), it has been shown that 36bi is actually a NAD(P)H:quinone oxidoreductase (reference #1).

        

    LBA1001 belongs to the PFAM Flavoprotein clan (CL0042), which currently contains four families, including best known Flavodoxin Pfam domain (PF00258) (PFAM e.value of 0.001), but it is likely to form a new family in this clan. Flavodoxins are electron-transfer proteins that function in various electron transport systems. They bind one FMN molecule, which serves as a redox-active prosthetic group and are functionally interchangeable with ferredoxins. During the structure determination and refinement, electron density clearly revealed the presence of an FMN prosthetic group. The presence of this FMN prosthetic group and structural similarity with NADH:Quinone Oxidoreductase WrbA from E. coli could perform a similar role as an oxidoreductase in Lactobacillus acidophilus.  The biologically-relevant oligomerization state most likely is a monomer. The structure LBA1001 is a classical flavodoxin fold, and is comprised of a central five-strand parallel beta-sheet surrounded by two α-helices on both sides of the sheet.

    monomer_ribbons.png

     Ribbon representation of the YP_193882.1 monomer. A tightly bound FMN cofactor is shown as sticks.

        

    GD9765C_edensity_oxidized_mse.bmp

     During the course of the crystallographic refinement, additional electron density was observed surrounding the sidechain of SeMet 46 (Mse 46) in the vicinity of the FMN cofactor. The relatively enhanced resolution of the refinement strongly suggested that this residue can be modeled as an oxidized SeMet with the modification showing stereoselectivity. The image shown above shows the structure in the vicinity of the oxidized SeMet 46 with 2fo-fc contoured at 1.5 sigma (blue) superimposed on the structure.

        

    A SSM search was performed using the refined structure of YP_193882.1. The top hits from this search are listed:


    PDB ID 2fz5 Chain A- rmsd=2.1 Å sequence identity=22% LALI=112 SOLUTION STRUCTURE OF TWO-ELECTRON REDUCED MEGASPHAERA ELSDENII FLAVODOXIN


    PDB ID 2a5l Chain A rmsd=2.2 Å sequence identity=21% LALI=11
    THE CRYSTAL STRUCTURE OF THE TRP REPRESSOR BINDING PROTEIN WRBA FROM PSEUDOMONAS AERUGINOSA

     


    PDB ID 1zes Chain C rmsd=2.3 Å sequence identity=21% LALI=93
    BEF3- ACTIVATED PHOB RECEIVER DOMAIN


    PDB ID 3b6k Chain B rmsd=2.1 Å sequence identity=21% LALI=116
    WRBA FROM ESCHERICHIA COLI, BENZOQUINONE COMPLEX

     

        

    overlap.bmp

    Least squares superposition of the structures of YP_193882.1 (green) and the solution structure of thetwo-electronreduced flavodoxin from Megasphaera elsdenii (blue)

    The most significant structural difference between YP_193882.1 and related structures is the presence polypeptide insertion between residues 35 and residues 68. The conserved sidechains Met 46 and Tyr 47 implicated in a possible catalytic mechanism are found on this loop. This insertion region is likely to be part of a cleft that helps position a potential substrate near FMN for electron transfer.

        

    3) Sequence comparisons

        

     LBA1001/YP_193882 is closely homologous to several proteins from various Lactobacillus species, variously annotated as trp repressors or flavodoxins, but the differences in these annotations reflect different annotation protocols rather then differen functions of these proteins,  Top five homologs as identified by NCBI BLAST search are:

    ref|YP_001577448.1|putative trp repressor binding protein [Lactobacillus helveticusDPC 4571] Score =228 bits (580),Expect = 1e-58, Method: Compositional matrix adjust. Identities = 109/150 (72%), Positives = 130/150 (86%), Gaps = 1/150 (0%)

        

    ref|YP_807409.1|Flavodoxin [Lactobacillus casei ATCC 334] Score = 99.4 bits (246),Expect = 8e-20, Method: Compositional matrix adjust.Identities = 56/145 (38%), Positives = 81/145 (55%), Gaps = 6/145 (4%)

        

     

    ref|YP_193978.1| putative flavodoxin [Lactobacillus acidophilus NCFM] Score = 97.4 bits (241),Expect = 3e-19, Method: Compositional matrix adjust. Identities = 50/94 (53%), Positives = 62/94 (65%), Gaps = 6/94 (6%)

        

    ref|YP_001988328.1|Flavodoxin [Lactobacillus casei] Score = 96.3 bits (238),Expect = 6e-19, Method: Compositional matrix adjust. Identities = 55/145 (37%), Positives = 80/145 (55%), Gaps = 6/145 (4%)

        

    gb|ABO43857.1| conserved hypothetical protein [Lactobacillus reuteri] Length=158 Score = 90.5 bits (223),Expect = 4e-17, Method: Compositional matrix adjust. Identities = 53/135 (39%), Positives = 82/135 (60%), Gaps = 3/135 (2%)

        

    None of these top scoring homologs is structurally characterized.

        

        

    The genes surrounding YP_193882.1 have been sequenced . An ATP-DNA dependent helicase and an exonuclease subunit immediately flank the YP_1938832.1. Immediately below is a table of the neighboring genes:

    http://spock.genes.nig.ac.jp/~genome/cgi-bin/neighbor.pl.cgi?org=laci0&gene=AAV42851.1

        

    [-5] AAV42846.1 +970077972170 ornithine decarboxylase chain A
    [-4] AAV42847.1 +972197973459 aluminum resistance protein
    [-3] AAV42848.1 -973896974567 NAD+ binding protein for K+transport
    [-2] AAV42849.1 -974560975900 Na+-transporting ATP synthase
    [-1] recQ+976061977833 ATP-dependent DNA helicase

     

    0-0-1216742590-esp.300.png

     Amino acid sequence alignment for YP_193882.1.1 and the top scoring amino acid sequence sdentity hits from the NCBI BLAST seach. Residues that are strictly conserved include (red) several residues at the N-terminal region. Three residues in the immediate vicinity of the active site sulfur, Tyr 14, Tyr 27, and His 31 are strictly conserved across the homologues. This region at the N-terminus includes some residues that interact with the phosphate moiety on the FMN cofactor in the structure. Tyr 47, a residue implicated to be involved in catalysis and described above in the structure summary is also at the active site.

        

        

        

    6) Literature

    1. Andrade, S.L.A et al. “Crystal Structure of the NADH:Quinone Oxidoreductase WrbA from Escherichia coli” J. of Bacteriol. (2007) pp. 9101-9107.

     

    Ligand Summary

    The FMN cofactor binds at one end of the monomer with the plane of the isoalloxazine ring on the flavin moiety perpendicular to the long axis of the monomer. One side of the planar face of the isoalloxazine ring is partially exposed to solvent. On this solvent exposed face, the sidechains of Mse 46 and Tyr 47 are nearby. On the opposite side of the isoalloxazine ring is situated the sidechain of Trp 86 with the carbonyl oxygen atom of Val 85 within van der Waals contact distance to the center of the cofactor ring.Thecrystal structure shows that the sidechain of Tyr46 from a lattice symmetry-related molecule is within hydrogen bonding distance of the modified Mse 46, and this Tyr 46 on a lattice symmetry-related molecule is within van der Waals contact distance of the FMN cofactor. Although size-exclusion chromatography and packing calculations indicate that the predominant oligomerization state on YP_193882.1 is a monomer, the crystal structure at this lattice interface is similar to the structure at the active site of the E coli structural homolog where the active site is comprised of residues from three different subunits. In contrast, the structure described here is a monomer in solution. The structure at the interface of the symmetry-related molecules in crystals of the YP_193882.1 protein near the FMN binding site could have implications for how FMN interacts with potential redox partners.fmn_region_monomer.bmp

          

          

          

          

          

          

          

          

          

          

          

          

          

          

          


    Structure of YP_193882.1 in the vicinity of the FMN cofactor.


    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch