The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function (RER070207001348) from Eubacterium rectale at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 3e0z Target Id 388609
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS17962,YP_002936966.1, RER070207001348, 89024 Molecular Weight 12463.56 Da.
    Residues 108 Isoelectric Point 4.86
    Sequence mitsiarqsiilkclrqksvlvsnyelyytaglakkcfgiavdadmepkqlleelqkhidkvspadeqe kylihllgnyepddthdeqtvelfhmgeteehiwqvsit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.75 Rfree 0.219
    Matthews' coefficent 1.82 Rfactor 0.171
    Waters 394 Solvent Content 32.45

    Ligand Information


    Google Scholar output for 3e0z

    Protein Summary

    The EUBREC_1070 gene from Eubacterium rectale encodes the YP_002936966 amino acid sequence, a protein of unknown function. The sequence is not in PfamA and does not give any strong hits in remote homology detection servers such as HHPred or FFAS. ZP_04742165, a protein with 50% identity to this target, is annotated as putative imidazole glycerol phosphate synthase subunit HisF.

    Similarly, 3e0z does not provide any significant hits in structural similarity searches (DALI top hit is a phosphatase (PDB id: 1LAR) with Z-score 3.7 and 10% seq.id.; FATCAT top hit is a transcription associated factor (PDB id: 1H3O) with P-value 3.34e-03).

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch