.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dzz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative pyridoxal 5'-phosphate-dependent C-S lyase (YP_813084.1) from LACTOBACILLUS DELBRUECKII BULGARICUS ATCC BAA-365 at 1.61 A resolution. To be published
    Site JCSG
    PDB Id 3dzz Target Id 377395
    Molecular Characteristics
    Source Lactobacillus delbrueckii subsp. bulgaricus atcc baa-365
    Alias Ids TPS17306,YP_813084.1, 3.40.640.10, 335798 Molecular Weight 43992.97 Da.
    Residues 390 Isoelectric Point 5.02
    Sequence maekqydfthvpkrqgnsikwgvlkekelpmwiaemdfkiapeimasmeeklkvaafgyesvpaeyyka vadweeiehrarpkedwcvfasgvvpaisamvrqftspgdqilvqepvynmfysviegngrrvissdli yenskysvnwadleeklatpsvrmmvfcnphnpigyawseeevkriaelcakhqvllisdeihgdlvlt deditpaftvdwdaknwvvslispsktfnlaalhaacaiipnpdlraraeesfflagigepnllaipaa iaayeeghdwlrelkqvlrdnfayareflakevpevkvldsnasylawvdisalgmnaedfckylrekt gliisagngyrgnghefvrinlacpkelvidgmqrlkqgvlnlnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.61 Rfree 0.175
    Matthews' coefficent 2.06 Rfactor 0.144
    Waters 575 Solvent Content 40.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dzz

    Protein Summary

    The LBUL1103 (patC) gene from Lactobacillus delbrueckii bulgaricus atcc baa-365 encodes a PLP-dependent aminotransferase (PF00155, COG1168, EC 2.6.1.-). The structure contains two domains and adopts a PLP-dependent transferase-like fold with significant structural similarity to cystalysins (PDB ids 1C7N, 1D2F), aspartate aminotransferases (PDB ids 1J32, 1O4S) and other aminotransferases of varying specificities. A search with PSI-BLAST indicates that the protein is likely as a beta-cystathionase. Previous work has shown that this enzyme can have a dual role, functioning both as a beta-cystathionase and as a modulator of maltose gene expression [Ref].

     

    To do: identify PLP site, catalytic residues, ligand?

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch