.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dxq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of choline/ethanolamine kinase family protein (NP_106042.1) from MESORHIZOBIUM LOTI at 2.55 A resolution. To be published
    Site JCSG
    PDB Id 3dxq Target Id 386994
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS17749,NP_106042.1, 89042 Molecular Weight 32971.98 Da.
    Residues 300 Isoelectric Point 5.76
    Sequence mmtdearaklaaipmlagytgplerlggltnlvfragdlclripgkgteeyinraneavaareaakagv spevlhvdpatgvmvtryiagaqtmspekfktrpgsparageafrklhgsgavfpfrfelfamiddylk vlstknvtlpagyhdvvreaggvrsalaahplplaachcdplcenfldtgermwivdweysgmndplwd lgdlsvegkfnanqdeelmrayfggearpaergrvviykamcdllwtlwgliqlandnpvddfrayadg rfarckalmetpefsrhlaavrmg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.284
    Matthews' coefficent 2.63 Rfactor 0.242
    Waters Solvent Content 53.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dxq
    1. Genomics, evolution, and crystal structure of a new family of bacterial spore kinases
    ED Scheeff, HL Axelrod, MD Miller - Proteins: Structure, , 2010 - Wiley Online Library
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The mll5367 gene from Mesorhizobium loti encodes a choline/ethanolamine kinase (PF01633, COG0510, EC: 2.7.1.32). The structure comprises two alpha+beta domains with a protein kinase-like fold that shows significant structural similarity to human cholin kinases (PDB id: 2IG7, 2I7Q). In bacteria, choline kinase is predicted to be involved in lipopolysaccharide (LPS) biosynthesis. The presence of phosphorylcholine on LPS has been shown to differentiate commensal from pathogenic bacteria [Ref], suggesting that this enzyme may play a broader role in immune avoidance.

     

    To do: look at ATP/choline binding sites

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch