.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dv8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcriptional regulator, Crp/Fnr family (RER070207001219) from Eubacterium rectale at 2.55 A resolution. To be published
    Site JCSG
    PDB Id 3dv8 Target Id 388639
    Molecular Characteristics
    Source Eubacterium rectale
    Alias Ids TPS14545,RER070207001219, 2.60.120.10, 104701 Molecular Weight 25297.99 Da.
    Residues 219 Isoelectric Point 5.99
    Sequence msfenyfplwndlntaqkklisdnlitqhvkkgtiihngnmdctglllvksgqlrtyilsdegreitly rlfdmdmcllsascimrsiqfevtieaekdtdlwiipaeiykgimkdsapvanytnelmatrfsdvmwl ieqimwksldkrvasflleetsiegtnelkithetianhlgshrevitrmlryfqveglvklsrgkiti ldskrletlqrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.262
    Matthews' coefficent 3.53 Rfactor 0.222
    Waters 67 Solvent Content 65.19

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dv8

    Protein Summary

    The EUBREC_1222 gene from Eubacterium rectale encodes the YP_002937116 amino acid sequence that folds into a two-domain protein with a cyclic nucleotide binding domain (PFAM:PF00027, residues 28-115, COG0664) followed by a bacterial regulatory domain (PFAM:PF00325, residues 167-197).

    The N-terminal domain (1-150) belongs to the all beta class, cAMP-binding domain-like superfamily. The C-terminal domain adopts a DNA/RNA-binding 3-helical bundle fold, winged-helix DNA binding domain superfamily, CAP C-terminal domain-like family. Several structurally similar proteins have been solved by structural genomics [PDB id: PDB:1O5L(Z=12), PDB:2GAU(Z=22), PDB:2ZCW(Z=20)] and show strong structural similarity to PDB:3dv8. DALI top hits are with Crp/Fnr transcriptional regulators like PDB:2gau (Z=22), PDB:3d0s, PDB:2zcw and PDB:2coh (Z=20).

    For more information on the structure/function [Ref], activation [Ref] and modes of allosteric regulation  [Ref] [Ref] [Ref] [Ref] of this protein, see the associated publications. It is that a structure comparison of 3dv8 and 1g6n (chain A, as mentioned in [Ref]) does not confirm a conservation of the cAMP binding site in 3dv8!

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    4. (No Results)

       


      Discuss this publication
    5. (No Results)

       


      Discuss this publication
    6. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch