| Title | Crystal structure of an alpha/beta hydrolase (YP_496220.1) from Novosphingobium aromaticivorans DSM 12444 at 1.50 A resolution. | | Site | JCSG | | PDB Id | | Target Id | 387108 | | Molecular Characteristics | | Source | Novosphingobium aromaticivorans dsm 12444 | | Alias Ids | YP_496220.1 | Molecular Weight | 31466.08 Da. | | Residues | 284 | Isoelectric Point | 4.87 | | Sequence | maeyedrywtssdglrlhfrayegdisrppvlclpgltrnardfedlatrlagdwrvlcpemrgrgdsdy akdpmtyqpmqylqdleallaqegierfvaigtslgglltmllaaanpariaaavlndvgpevspegle rirgyvgqgrnfetwmhaaralqessgdvypdwditqwlryakrimvlgssgriafdydmkiaepfeap vgatpqvdmwplfdalatrpllvlrgetsdilsaqtaakmasrpgvelvtlprighaptldepesiaai grllerv | | | BLAST FFAS |
| Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.50 | Rfree | 0.203 | | Matthews' coefficent | 2.00 | Rfactor | 0.161 | | Waters | 336 | Solvent Content | 38.41 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 14 | | Metals | CA (CALCIUM) x 2;CL (CHLORIDE) x 2 | | |
Protein Summary
This protein is an alpha/beta hydrolase. It shares both sequence and structural similarity to other alpha/beta hydrolases according to
BLAST (best hit to
gi|87198963|ref|YP_496220.1| , E-value: 9e-147),
FFAS (best hit to a haloalkane dehalogenase from a
Rhodococcus species with score: -76.000,
PDB code:
1bn6 ), and
DALI (hits to 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd)
from
Rhodococcus sp. strain rha1, Z-score: 23.9, RMSD: 3.1, PDB code:
1c4x and a haloalkane dehalogenase at ph 5.0 containing chloride, Z-score: 22.6, RMSD: 2.8, PDB code:
1b6g). 1b6g has a catalytic triad composed of Asp124, His289, and Asp260. The catalytic triad is conserved in this protein and is composed of: Ser105, His 265, and Asp239.
Ligand Summary
References