.
The Open Protein Structure Annotation Network
PDB Keyword
.

399656

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 399656
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS30601,NP_786051.1 Molecular Weight 15167.52 Da.
    Residues 140 Isoelectric Point 4.93
    Sequence mkiivsghgnyasglqstihllagdianieyidftdnmddiqlserfqravigennvvfmcdllggtpf keavklsqvsekdiavtsgcnvgallevgfelttysapakklaeklvkisqvqtkvfhhqaiqvddgve gi
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch