The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 399633
    Molecular Characteristics
    Source Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
    Alias Ids TPS29752,YP_010851.1, _0055.000954_, _0034.000900_, _0035.002793_, 328205 Molecular Weight 15058.49 Da.
    Residues 145 Isoelectric Point 5.38
    Sequence mtekdnvearvgviivthadygsallraaefilgaqsdctsisidvsqevgetvtrlkeavgrldkgng aiiltdmfggtptnlslsllatsnvevvtgvnlpmllkvfgsrtmplaqlaaeageaggkgiivagqml rsktrng
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch