.
The Open Protein Structure Annotation Network
PDB Keyword
.

399555

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 399555
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS29744,NP_346806.1, _0019.001778_, 327896 Molecular Weight 17816.47 Da.
    Residues 157 Isoelectric Point 6.13
    Sequence mdkiinnkheiaynslnlafaltdldkktryfgtdvpifhseihvikaiaehpgihvggladilgvtkg avseilkklerkalvikeidslnlsryslsltekgkkahsnhmlyhsiinnmveeelqnasehelefls nflstlinkveffnknfde
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch