The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 399386
    Molecular Characteristics
    Source Pseudomonas putida kt2440
    Alias Ids TPS28012,NP_745095.1, _0052.002647_, _0019.000163_, _0081.003627_, 323464 Molecular Weight 20780.63 Da.
    Residues 188 Isoelectric Point 6.10
    Sequence mtdtrekilataekliyengihatgmdllvktsgvarksiyryfankddvaaaalnardirwmtwfrse cekaqtpearilgifdalkswfesdgfrgcafintagevgnaddpvrqiaklhkqklldytleltselg vndptglakqllliiegtitvahvmgdhtaldsareiakvllkdvqrasa
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch