.
The Open Protein Structure Annotation Network
PDB Keyword
.

399039

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 399039
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS29676,YP_211664.1, _0111.000795_ Molecular Weight 26188.07 Da.
    Residues 225 Isoelectric Point 8.67
    Sequence mygnkivfsglenikdcckmkitrdelliaafklfmsvnyekasfaelgkmlgmskagifkyyknkqel fiavvdkfwfstqnprnkftetngtfaefideyvrgvqrtmdmlgdligaerekvaqgkftyhaqyfhf lfqllqydpdakeklrnlvevdyaywraaiqraiatgelredvdvedavvmfrqvymglsfemafmggl ntqrlakhlhavysllkr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch