The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 396618
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27948,YP_001304204.1 Molecular Weight 57307.70 Da.
    Residues 500 Isoelectric Point 4.70
    Sequence dldenvydklptdefgttekqinaimapayqslknmlaydgpwgaadmtadiliaptrvggdwwdggqy meqcmhswkpnsysvencwtycteglttvnsvyniiekseamsdelklqylselrglrafwyyvivdif gnaplvtdfedtslpsitsradlykyvvkelteiipnlrsdvsdasygkftqgaarmvlakmylnaeew igepnwkgvveqcdeimkleyiiepnwktnfevhnevsreiifpicykasdawgnsihlwtlhyldpdv lgftggmwnginaqpdfvrtfdtedpryegsfligpmidpstgeilkttlghdlihtidlnvvpgtekt dadgnltpwgevhqedgarinkwvyekgmqntnmendiaifrladvylmkaealvrmggdlgeatrlvn aireraygnsdhnytsvtlddiynergyelafefvrrqdmirfgtylkprymkpkqtpeyrkifpipfk awqknnnlvqnpgypaf
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch