The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 396442
    Molecular Characteristics
    Source Shewanella denitrificans os217
    Alias Ids TPS26662,YP_563270.1, 3.10.450.50, 327721 Molecular Weight 14022.18 Da.
    Residues 126 Isoelectric Point 6.08
    Sequence gsketesrllhlvnqhvdaqtqfdsgtltsitdesymevspagevdprakmlefyapehkrpgpvvafe epkiriygdtavilgklaysmtlpqgdqrhfamrgtwvaskigadwklvsaqftair
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch