The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 396250
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS27916,CHUT_08NOV04_CONTIG199_REVISED_GENE3255 Molecular Weight 31180.02 Da.
    Residues 274 Isoelectric Point 8.53
    Sequence sctsqkkklakmhtedtivkaqliqhtkesllspyqhvnfqldltknktafygyntgskwelwvktdst itfkydgeemvfssaktteaqdnpvvkyhsktivsnpsqpglkksitvmirdekyldeiqgtyvplsvr ievedhtnkttviyagggfyvvnpiihdiwvldsmsnvkvsaenfplgaprlefhldggkiygfsgcne itatfytiqnqiqlnseistlkscvhvpleplfmgalankryyysfeerrlklkhrdgsilsfkkvd
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch