.
The Open Protein Structure Annotation Network
PDB Keyword
.

394720

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 394720
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27897,YP_001303981.1 Molecular Weight 37713.38 Da.
    Residues 335 Isoelectric Point 8.55
    Sequence arpqekikkkeisqsysvsagdrlqvenrygnitvthwnqntvairveveckarseeraqenldriqie tkkiggivsavttikkemnsnsnnesmtinyyiqmppklaadlnqkygninlpsdnngnmdihvkygnl nagnftanamieakygnievgnlqdaqldlgyvgtakirnakdltidskysnldiqdiqslrmeikygn ltiesvsrldmeikysdakigtlkdalnvsslsysnlkirnlspsfskvnveshygnlevalpaktsfr ivaenmkysscdvngfnitrkhfddedrdknytyeinggkqptihfegnrygnlkvkan
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch