.
The Open Protein Structure Annotation Network
PDB Keyword
.

394551

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 394551
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS27879,NP_786194.1, _0023.002889_, 326766 Molecular Weight 20155.85 Da.
    Residues 179 Isoelectric Point 5.16
    Sequence mrkvqfygaisidgclatkdnrldwlfktagandapteafmqqvdtaimgrhtyeytmeqttdqlinpy npathnivmtshphtgdertqftntpvtkivedlrrtagkniwivggagvlmpllaadlvdelyiqiap vilgdgiplfkaidqqqrfelvdtnrygqlaevhyqrltte
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    Note from PFAM:  RibD_C (PF01872)

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch