The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394536
    Molecular Characteristics
    Source Thermoplasma volcanium gss1
    Alias Ids TPS29524,NP_111590.1, _0097.000766_, BIG_195, _0120.001619_, 326374 Molecular Weight 38014.62 Da.
    Residues 338 Isoelectric Point 6.18
    Sequence miavlrinhrpfrdkritthvaltarafgassilvdekdetleqtinkvvenfggnffiksgvdwkref rnfkgirvhltmygrpledvvkeireskkdvmilvgsekvpfeayeiadynvsvtnqpisevsalaifl drfydgeelnwrftgkinvypsergkkvkiipdeqgcldllykygasdylinhvksvkelavaiakktn adinlvtagallhdigrtqvqgithavvgadilrregiddrvvsivekhigagiqseeavklglppdny vpetieemivahadnlfagdkrlklqqvvdnyrkkgledaaeriaklhkflstvigqdmdei
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch