.
The Open Protein Structure Annotation Network
PDB Keyword
.

394414

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394414
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS27859,YP_001636234.1, _0106.000668_, _0032.000316_, 332995 Molecular Weight 40223.99 Da.
    Residues 377 Isoelectric Point 5.27
    Sequence mkltcmqedlkrglaavghavagkstlpvlanillatdegrlkltatnlevginrwisatitrdgavav paklltdvvgglpndkvtlsldqktqtlrvecgrfvsnikgvdadefpslptvsaqtplvslpaevwqe aidqvafaaatdesrpiltgvlvrtrdqqvtlvaadgfrlamrtiqlsapvahavdclipartlselar iigdtdaevamvytpggshvlfhtenievvsrliegrfpdferiipqqyltrmvldnselakavklasf fagssqnvvklkiepaselapgrvvisanaaelgdntseldgsvtgeggvialnvrfladaiaavhsnq iafemqsaqspavfkpvgqdgyihivmpmsmr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch