The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394359
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS25306,YP_001092750.1, _0085.003059_, 326370 Molecular Weight 55449.18 Da.
    Residues 495 Isoelectric Point 4.93
    Sequence meaeielklffpenkrealvsllnslphsdakgaihltnsyydtpdlqlrrwdmglrirgrdgqfeqti ktagtvvggvhsrpeynididqakvnlslfpteiwpegaeigpvqdalvslfdtdftrmswhiyldesl vevaldigsisangqcepicelefellagdaqallalaervteqiparlgraskaqrgyrlaamasplq ldtlafialpkkgtpkqalvtlletgldrwqlleemllesrqaarqlpllgyrlracirllrctlaqfs llddkllqafdaiesqlsfvdkglslcelldgdgallsnlsepeglldavrhelaalempqkidamlnh vtygqlqvrlvsllmavnagqvyiseqqslqafadrlqeaswqqivdlmpsnaelssedyqsfakalde silvgvaygelykhksrdqfrapwqdlvlgirtlgayhslrqtaatqgrdiddwldskeqsllfamehs rrsalkvqpywr
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch