The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394251
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS29512,NP_982098.1, _0106.000668_ Molecular Weight 41163.40 Da.
    Residues 370 Isoelectric Point 6.22
    Sequence mkftinrtlfieklekasatvdvknpmpalqgvlldcnskgmilmgsdgtetvtlvtrfnvnsgdctep gkvlfaaapvlktikkfksefiglehknnelkiveskkkqfsfctmdheeypeikieagedwislsqeq fvsmangtlhaipamdtrkiltgvnlksvddkffsiatdahrlarlhfdctkitiakdgevvlpikslk talklfnretnlqlklisdtqllirgesiiyqsrllagtypdtarmvpdefkseiqlsreefkntleql safsslivltsegkesihlkpqnsqvgtasveipcnqveaftlacnveyllqalqtitsetiaikmisn qrpivvvgaedtthsnlqlilpvrv
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch