.
The Open Protein Structure Annotation Network
PDB Keyword
.

394160

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394160
    Molecular Characteristics
    Source Listeria innocua clip11262
    Alias Ids TPS27832,NP_472295.1, 3.40.640.10, _0046.002759_, 332988 Molecular Weight 38307.67 Da.
    Residues 350 Isoelectric Point 5.24
    Sequence mkklvataprvaelveyhdrevvedevkikvqfaspkhgtevvdfrgispfideefspewnlfvsretn sargivfgefqlgnmvvgevvecgskvteyalgdivcsygpimetvivkavdnyklrklpkganwknav cydpaqfamsgvrdahvragdyvvvvglgaigqiaiqlakkagasvvigvdplshrreiaekhgadatf dpittdvglevkrltgklgadsiietsgnaaalqaalrgiayggtisyvafakpfpegfnlgreahfnn akivfsraasepnpdyprwdrkrieetcwellmngyldctdiidpvvpfadsaesymkyvdqqpdlsik mgitl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch