.
The Open Protein Structure Annotation Network
PDB Keyword
.

394069

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394069
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS26603,YP_559595.1, _0055.004100_, _0054.000837_, 325458 Molecular Weight 34838.91 Da.
    Residues 327 Isoelectric Point 4.98
    Sequence mtvadlvaglresrgfrhktdivdvvgslakrlprgkrdlaqavalgddcaaladgdgyllfaiegmvs dfvsampwfagyssvmvnvsdiyamggrplavvdalwsqgigaaeevlagmaaasvaygvpivgghtnt rseaaqlavsiigrarallssfnakpgdslmmavdlrgrfeepypfwnasvdapperlradlellpqla englcdaakdismagtlgtalmllecsqvgaridlacipkpegvplerwvsafpsfgyllsvrpehvet vrakfsarslacsvigsvdatsqvvlhrqddaatlwdfqrepfiigkdevk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch