.
The Open Protein Structure Annotation Network
PDB Keyword
.

394028

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 394028
    Molecular Characteristics
    Source Syntrophomonas wolfei subsp. wolfei
    Alias Ids TPS25282,SWOL_07JAN05_CONTIG98_REVISED_GENE2435, _0037.000821_, 332931 Molecular Weight 31153.95 Da.
    Residues 280 Isoelectric Point 4.96
    Sequence lnkitldsiveavnelpalphivvrimqlsedpdstvqdisnvlnqdqamtarvlrlansaffgfprri stvtdaivflgfktirsivlavsvsnildremegyalehgelwrhsqcsaiaarmiarkckfgsldlay taallhdigkvilndhmkeayhevvarvdennisfmeaenevfgfnhaqvgarvaekwnlpselvesia lhhnpqdavlnqrltsivhladaicvsmgigigidgmlypiseeamkllnfdeiqvertiselvdvfsd qqsf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch