The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 393271
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS24972,YP_001299982.1, 324149 Molecular Weight 15297.01 Da.
    Residues 139 Isoelectric Point 5.01
    Sequence dndekgdvtkpvidliepeegavlkigngkgvhfemnlsddvmlrsykinihnnfdhhghdsraagekn taftfdkvydvsglkntkvhhhdivipadaapgdyhlmvwctdaagnqtevarnivlsadggtetehdhe
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch