The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 392324
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS27741,MMAG_12JAN01_CONTIG3880_REVISED_GENE4174 Molecular Weight 16695.06 Da.
    Residues 156 Isoelectric Point 5.44
    Sequence vsksafkalvaqvtssiaglpvdaslgavlnarfpedgelfksieaachkaigegwmcenehggirygr vaeadselsgfsidvvhmkdvagprhrhplgeidmimsidpaakfdgaprgwlvygpdsvhrptltega alvlyllpdgqidfsrpk
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch