The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 392225
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS24812,NP_599934.1, 397310 Molecular Weight 39495.66 Da.
    Residues 355 Isoelectric Point 4.55
    Sequence mkksivvfeveggsdkhfdghrkdtmpivnsindagwqaevvyyrpewteglfeyvsenfdgyisrvnp gnipggergyfdlltrlseaglvgmstpeemmaygakdalvklsqtdlvpsdteayydvetfhkvfpts lsfgervlkqnrgstgsgiwrvqlvdkelaasiepgtalpldteikcteavdnhtevrklgefmdfcdq yiigdngmlvdmrfmprivegeirillvgphpvfvvhkkpaeggdnfsatlfsgakytydkpeqwqeli dlfadarpviaeklggdnipliwtadfmlgdvvdgkdtyvlgeincscvgftseldmgiqqlvaseaik rieefaqltv
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch