The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 391486
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS20895,SSUI_28JUL04_CONTIG216_REVISED_GENE696 Molecular Weight 29395.32 Da.
    Residues 253 Isoelectric Point 4.84
    Sequence msnqlenaknlylrgirdgeikevhenymgasytqhstgvpdekegfaaffedffkrnpkreinivrai edgnfvfvhvhqklndgeaewvtadifrsdengrivehwdvidaypktidqtdpiyadfeltdldkted nkkivrrflvdvfqngeidkfddyvaanliqhnqeiaqggaaykdylvdkavnydfvfkvmgqgdyvva yskvwiagqdyahfdiyrlkdgkivehwdnkevmpdkkdltnlgkf
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch