.
The Open Protein Structure Annotation Network
PDB Keyword
.

390997

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390997
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS20194,MMAG_12JAN01_CONTIG3786_REVISED_GENE1332, 2.60.120.10, 85313 Molecular Weight 24464.92 Da.
    Residues 219 Isoelectric Point 9.01
    Sequence mneisaplapspspgepkmeklavaagatlfrqgdagdaayilekgkimifqqvegqrveldtirpgei fgemavidstermatavaatdcsvtrvpqaifnrkleatdkfvralvnmfiknirtshrifvrrprsfr dniklirffafniqryarlmddrplgdemlaalekvekavadlaeigsrakdkrhdhimeegdahnvgl ksvmgteghrkl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch