The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390934
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS20176,NP_786010.1,, 85278 Molecular Weight 20057.67 Da.
    Residues 186 Isoelectric Point 5.26
    Sequence mttnspleaimnarhsvrqydgqtkigreemaamlqtaflaptalnqqpiralviedaalrqrlcaatg ntsqlttasavvlfvldrenqhqapafqasqgqqfdtgdetigaldagliamqfmlvakdhgfdtnpmt gfdaagftsileldaqryrplllvsigkaavagkpadhqplatlvdyr
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch