.
The Open Protein Structure Annotation Network
PDB Keyword
.

390835

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 390835
    Molecular Characteristics
    Source Exiguobacterium sp. 255-15
    Alias Ids TPS18286,YP_001815434.1 Molecular Weight 23461.52 Da.
    Residues 211 Isoelectric Point 4.63
    Sequence mttqtttdfmeivkgrrsirnydtnvkiskeemtqileeatlapssvnmqpwrflvidsaegkatlapla kfnqvqvetssaviavfgdmnavdsietiydmavekglmpqevrdrqvpaikgfyspedtdtlrdsili dsglvsmqlmlvarahgydtnpiggyekdqiaeafgmdkdrylpvmllsigkavdagypsvrlpindit dwk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch