.
The Open Protein Structure Annotation Network
PDB Keyword
.

390822

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 390822
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS14625,NP_814580.1, 3.40.640.10, 85542 Molecular Weight 40131.89 Da.
    Residues 368 Isoelectric Point 6.11
    Sequence mtisyekfhlkevinasgkmtilgvskvseavlaaqrfggehffemselsvqtgaflanllkvedaqiv ssasagiaqsvaaligkgslyhayhpytekieqreivlpkghnvdygtpvevmvaqgggqvveagyanm cspehvemmisektaailyikshhtvqksmltvaeaakvaqrhkvplivdaaaeedlfkyteagadlvi ysgakaiegpsaglvvgkkeyidwvrlqgkgigramkigkdnilgftqaveeylahgsesgasmqerlk pfveainnlsdltakivqdgagrdiyrasvkvdgrktakeviqalkaespaiytreyqanngiiefdir svnqeemnkivqrlqeimdkkek
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch