.
The Open Protein Structure Annotation Network
PDB Keyword
.

390734

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 390734
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS14611,NP_282584.1, 3.40.50.10490, 104466 Molecular Weight 33916.87 Da.
    Residues 315 Isoelectric Point 5.94
    Sequence mntleiakevfekeaqaildlatnldenfnqavnlmlntkgrcivsgmgksghigakiaatlastgtps ffihpgealhgdlgmltsedvliaisnsgeteeilkiipaikkreiplivmcgkknstlvkqgdiflni avekeacplqlapmssttatlvmgdalaaalmkvrnfkpddfalfhpggslgrklltkvkdlmvssnlp ivhpdtefndlvdvmtsgklglcvvleneklvgiitdgdlrralkasdkprfdfkakeimsinpkvvda damaseaegimlkhkikeiivgkeekvvgiiqlyaignv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch